DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and Dnajb5

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:XP_038966057.1 Gene:Dnajb5 / 313811 RGDID:1307453 Length:420 Species:Rattus norvegicus


Alignment Length:174 Identity:51/174 - (29%)
Similarity:76/174 - (43%) Gaps:42/174 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 HYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLYDK-- 90
            :|..|||.....::|||.||.|:::.||||:|: ..||.:||:||.:||::|.:.:.|.|||:  
  Rat    77 YYKILGIPSGANEDEIKKAYRKMALKYHPDKNK-EPNAEEKFKEIAEAYDVLSDPKKRSLYDQYG 140

  Fly    91 --------GIVHTAGAQYAQDVHDVAEPVVEDDAETKFYKSRFQKSRVSD-----SAGRTPIYDF 142
                    |....:|..:....|.       |...|  :.|.|..|...|     |....|...|
  Rat   141 EEGLKTGGGTSGGSGGSFHYTFHG-------DPHAT--FASFFGGSNPFDIFFASSRSTRPFSGF 196

  Fly   143 D------EWSRNHYGKSFDR----------RQAAQAKYDRIKVQ 170
            |      :...:.:| :|.|          |:|.:..|.|.|||
  Rat   197 DPDDMDVDEDEDPFG-AFGRFGFNGLSRGPRRAPEPLYPRRKVQ 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 26/60 (43%)
DnaJ 27..89 CDD:278647 26/60 (43%)
Dnajb5XP_038966057.1 DnaJ 72..415 CDD:223560 51/174 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.