DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and Dnajb13

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001005885.1 Gene:Dnajb13 / 308857 RGDID:1359131 Length:316 Species:Rattus norvegicus


Alignment Length:254 Identity:55/254 - (21%)
Similarity:89/254 - (35%) Gaps:87/254 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 MSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLYDK 90
            |.:|..|.:.|.....:||.||.||::..||.:: ....|.:.||:|.:||::|.:...|.:|||
  Rat     3 MDYYAVLQVNRNSEDAQIKKAYRKLALKNHPLKS-NEPTAPEIFRQIAEAYDVLSDPVKRGIYDK 66

  Fly    91 --------GIVHTAGAQ------YAQDVHDVAEPVVEDDAETKFYKSRFQKSRVSDSAGRTPIYD 141
                    ||....|:|      |.  .|...|.|..:     |:            .|..|..:
  Rat    67 FGEEGLKGGIPLEFGSQTPWTTGYV--FHGNPEKVFHE-----FF------------GGDNPFSE 112

  Fly   142 FDEWSRNHYGKSFD--RRQAAQAKYD--------------------RIKVQRETNRISGQT---- 180
            |.:...|....:|.  |.:..| |.|                    :||:.|......|.:    
  Rat   113 FFDAEGNDIDLNFGGLRGRGVQ-KQDPPIERDLYLSLEDLFFGCTKKIKISRRVLNEDGYSSTIK 176

  Fly   181 DMVLLAFIFAG-------------------VAVYLMFLAESSYDTPKQKAKERYRRDQE 220
            |.:|...:..|                   :...::|:.       |:|...|:||:|:
  Rat   177 DKILTIDVRPGWRQGTRITFEKEGDQGPNIIPADIIFIV-------KEKLHPRFRREQD 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 20/62 (32%)
DnaJ 27..89 CDD:278647 19/61 (31%)
Dnajb13NP_001005885.1 DnaJ 1..312 CDD:223560 55/254 (22%)
DnaJ 4..65 CDD:278647 19/61 (31%)
DnaJ_C 138..302 CDD:199909 14/98 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.