DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and Dnajc10

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001099956.2 Gene:Dnajc10 / 295690 RGDID:1307813 Length:793 Species:Rattus norvegicus


Alignment Length:76 Identity:30/76 - (39%)
Similarity:45/76 - (59%) Gaps:4/76 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 YDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLYD---- 89
            |..||:.:..:..||:.|:.||::..|||:|..:.||...|.:||:|||:|.:..||:.||    
  Rat    37 YSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHGDFLKINRAYEVLKDEDLRKKYDKYGE 101

  Fly    90 KGIVHTAGAQY 100
            ||:....|.||
  Rat   102 KGLEDNQGGQY 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 23/59 (39%)
DnaJ 27..89 CDD:278647 23/59 (39%)
Dnajc10NP_001099956.2 DnaJ 34..>132 CDD:223560 30/76 (39%)
DnaJ 35..97 CDD:278647 23/59 (39%)
PDI_a_ERdj5_N 129..229 CDD:239301
ER_PDI_fam 130..551 CDD:273457
Trxb 1 235..350
Trxb 2 348..463
PDI_a_ERdj5_C 453..550 CDD:239302
PDI_a_ERdj5_C 556..663 CDD:239302
PDI_a_ERdj5_C 670..775 CDD:239302
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 790..793
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.