DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and Dnajb4

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001013094.1 Gene:Dnajb4 / 295549 RGDID:1305826 Length:337 Species:Rattus norvegicus


Alignment Length:251 Identity:61/251 - (24%)
Similarity:97/251 - (38%) Gaps:69/251 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 HYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLYD--- 89
            :|..|||.:..|..:||.||.|.::.:|||:|: |..|.:||:|:.:|||:|.:.:.|.:||   
  Rat     5 YYHILGIEKGATDEDIKKAYRKQALKFHPDKNK-SPQAEEKFKEVAEAYEVLSDPKKREIYDQFG 68

  Fly    90 -KGIVHTAGAQYAQ----------DVHDV-------AEPVVEDDAETKFYKSRFQKSRVSD--SA 134
             :|:...||....|          |.|..       |.|.      ..|:..|....|.|:  ..
  Rat    69 EEGLKGGAGGTDGQGGTFRYTFHGDPHATFAAFFGGANPF------EIFFGRRMGGGRDSEEMEI 127

  Fly   135 GRTPIYDFDEWSRNHYGKSFDRRQAAQAKYD--------------------RIKVQRETNRISGQ 179
            ...|...|. :|.|.|.:..:....::.|.|                    |:|:.|:.....|:
  Rat   128 DGDPFSAFG-FSMNGYPRDRNSVGPSRLKQDPPIIHELKVSLEEIYSGCTKRMKISRKRLNPDGR 191

  Fly   180 T----DMVLLAFIFAG--VAVYLMFLAESSYDTP-----------KQKAKERYRRD 218
            :    |.:|...|..|  ....:.|..|.. :||           |.|...:::||
  Rat   192 SYRSEDKILTIEIKKGWKEGTKITFPREGD-ETPNSIPADIVFIIKDKEHPKFKRD 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 24/60 (40%)
DnaJ 27..89 CDD:278647 24/60 (40%)
Dnajb4NP_001013094.1 DnaJ 1..332 CDD:223560 61/251 (24%)
DnaJ 4..65 CDD:278647 24/60 (40%)
DnaJ_C 158..320 CDD:199909 16/90 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.