DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and Dnajc18

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:XP_006254608.1 Gene:Dnajc18 / 291677 RGDID:1310237 Length:357 Species:Rattus norvegicus


Alignment Length:202 Identity:51/202 - (25%)
Similarity:85/202 - (42%) Gaps:40/202 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LRGLYLSQRHQMSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEIL 79
            |||:...::.: ::||.||:....:..|:|.||.||::.:|||:| .:..|...|:.|..|:.:|
  Rat    71 LRGVQRIKKCR-NYYDILGVSHNASDEELKKAYKKLALKFHPDKN-CAPGATDAFKAIGNAFAVL 133

  Fly    80 GNYRLRRLYDK-GIVH-TAGAQYAQDVH---DVAEPVVEDDAETKFYKSRFQK------SRVSDS 133
            .|...|..||: |... |..|..|:..|   ||...:..::....|:...|..      |.|:|.
  Rat   134 SNPDKRLRYDEYGDEQVTLTAPRARPYHYYRDVEADISPEELFNVFFGGHFPSGNIHMFSNVTDD 198

  Fly   134 AGRTPIYDFDEWSRNHYGKSFDRRQAAQAKYDRIKVQRETNRISGQTD-----MVLLAFIFAGVA 193
                          :||.:...|.:..||.      :||.::  .||.     .:|...:...::
  Rat   199 --------------SHYYRRRHRHERTQAH------KREEDK--SQTPYSAFVQLLPVLLIVTIS 241

  Fly   194 VYLMFLA 200
            |....||
  Rat   242 VITQLLA 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 21/62 (34%)
DnaJ 27..89 CDD:278647 21/61 (34%)
Dnajc18XP_006254608.1 DnaJ 82..143 CDD:278647 21/61 (34%)
DUF1977 250..349 CDD:286411
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.