DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and Dnajb9

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_038788.2 Gene:Dnajb9 / 27362 MGIID:1351618 Length:222 Species:Mus musculus


Alignment Length:213 Identity:55/213 - (25%)
Similarity:94/213 - (44%) Gaps:51/213 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLLLRGLYLSQRHQMSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAY 76
            :|::..|.|:.:   |:||.||:.:..::.:||.|::||:|.||||:|: |.:|..|||||.:||
Mouse    14 ILMITELILASK---SYYDILGVPKSASERQIKKAFHKLAMKYHPDKNK-SPDAEAKFREIAEAY 74

  Fly    77 EILGNYRLRRLYDKGIVHTA----------GAQYAQDVHDVAEPVVED---------DAETKFYK 122
            |.|.:...|:.||. |.|:|          |:.:.|..:...:.:.:|         ....|.::
Mouse    75 ETLSDANSRKEYDT-IGHSAFTNGKGQRGNGSPFEQSFNFNFDDLFKDFNFFGQNQNTRSKKHFE 138

  Fly   123 SRFQKSRVSDSAGRTPIYDFDEWS------------------------RNHYGKSFDRRQAAQAK 163
            :.|...:...|..|   :.|.|:|                        .|.:....:.|....:|
Mouse   139 NHFHTRQDGSSRQR---HHFQEFSFGGGLFDDMFEDMEKMFSFSGFDTTNRHTVQTENRFHGSSK 200

  Fly   164 YDRIKVQRETNRISGQTD 181
            :.|...||..|.::..||
Mouse   201 HCRTVTQRRGNMVTTYTD 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 28/62 (45%)
DnaJ 27..89 CDD:278647 28/61 (46%)
Dnajb9NP_038788.2 DnaJ 26..87 CDD:278647 28/61 (46%)
Divergent targeting domain. /evidence=ECO:0000305 91..222 21/131 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.