DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and SPAC4H3.01

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_594337.1 Gene:SPAC4H3.01 / 2543672 PomBaseID:SPAC4H3.01 Length:392 Species:Schizosaccharomyces pombe


Alignment Length:212 Identity:57/212 - (26%)
Similarity:89/212 - (41%) Gaps:62/212 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 HYDALGIRRQCTQNEIKAAYYKLSMLYHPDRN-QGSENAAKKFREINQAYEILGNYRLRRLYDKG 91
            :||.|||....|..:||.||.||::.||||:| ...:.|::||::|::||::||:.:||..||  
pombe     9 YYDLLGISTDATAVDIKKAYRKLAVKYHPDKNPDDPQGASEKFQKISEAYQVLGDEKLRSQYD-- 71

  Fly    92 IVHTAGAQYAQDVHDVAEPVVEDDAETKFYKSRFQKSRVSDSAGRTPIYDFDEWSRNHYGKSFDR 156
                                            :|.|.:.....|.|..|||   ..|.:|.:..|
pombe    72 --------------------------------QFGKEKAVPEQGFTDAYDF---FTNLFGGAPFR 101

  Fly   157 RQAAQAKYDRIKVQRETNRI-SGQ-TDMVLLAFIFAGVAVYLMFLAESSYDTP---------KQK 210
            ....:..:.:...:.|.:.: .|| .|...|             |.|||..||         |:.
pombe   102 EWVGELSFVKEMFREEDSAVEQGQMNDKQQL-------------LLESSEPTPTIKQQFNDRKKN 153

  Fly   211 AKERYRRDQEEREQKLV 227
            |:.|.|....:|||:::
pombe   154 AQIREREALAKREQEMI 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 27/61 (44%)
DnaJ 27..89 CDD:278647 27/61 (44%)
SPAC4H3.01NP_594337.1 DnaJ 7..>101 CDD:223560 38/128 (30%)
DnaJ 8..71 CDD:278647 27/61 (44%)
DnaJ-X 173..373 CDD:291006
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.