DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and SPAC4G9.19

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_593700.1 Gene:SPAC4G9.19 / 2543511 PomBaseID:SPAC4G9.19 Length:270 Species:Schizosaccharomyces pombe


Alignment Length:231 Identity:50/231 - (21%)
Similarity:87/231 - (37%) Gaps:54/231 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LWRPLLLLRGLYLSQRHQMSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAA------ 66
            |||.......  .|:...::.|:.|.:.|.||.|:||..|.:|...:|||:.:.:...|      
pombe    15 LWRRAASFTS--YSELKSLTPYEILELPRTCTANDIKRKYIELVKKHHPDKMKNASQLAPTESPP 77

  Fly    67 -------KKFREINQAYEILGNYRLRRLYDKGIVHTAGAQYAQDVHDVAEPVVEDDAETKFYKSR 124
                   :.||.:..|..:|.:.|.|..||:..:|     :.|..|. ..|..::.::.::  ..
pombe    78 EINKHNEEYFRLLLAANALLSDKRRREEYDRFGIH-----WNQPSHP-THPSPQNWSQARY--PT 134

  Fly   125 FQKSRVSDSAGRTPIYDFDEWSRNHYGKSFDRRQAAQAKYDRIKVQRETNRISGQTDMVLLAFIF 189
            :.:||.|...|        .|...:|.           .||.:..|..:|:.....|..:|  :|
pombe   135 YSRSRRSAGMG--------SWEEYYYN-----------SYDYMNDQNASNKNRKFDDEGML--VF 178

  Fly   190 AGVAVYLMFLAESSYDTPKQKAKERYRRDQEEREQK 225
            ||:...|:.:          .....||..:..||.:
pombe   179 AGILSILVII----------NIYSNYRNGKFYREAR 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 20/75 (27%)
DnaJ 27..89 CDD:278647 20/74 (27%)
SPAC4G9.19NP_593700.1 CbpA 29..249 CDD:225124 46/215 (21%)
DnaJ 32..>71 CDD:197617 13/38 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.