Sequence 1: | NP_001303469.1 | Gene: | CG11035 / 40953 | FlyBaseID: | FBgn0037544 | Length: | 231 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_593763.1 | Gene: | mug185 / 2542938 | PomBaseID: | SPAC6B12.08 | Length: | 380 | Species: | Schizosaccharomyces pombe |
Alignment Length: | 233 | Identity: | 60/233 - (25%) |
---|---|---|---|
Similarity: | 100/233 - (42%) | Gaps: | 42/233 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 MSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLYDK 90
Fly 91 GIVHTAGAQYAQDVHDVAEPV-----VEDDAETKFYKSRFQKSRVSDSA------GRT------- 137
Fly 138 -PIYDFDEWSRNHYGKSFDRRQAAQAKY-DRIKVQRETNRISGQTDMVLLAFIFAGVAVYLMFLA 200
Fly 201 ESSYD-TPKQK------AKERYR------RDQEEREQK 225 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11035 | NP_001303469.1 | DnaJ | 26..>89 | CDD:223560 | 27/62 (44%) |
DnaJ | 27..89 | CDD:278647 | 26/61 (43%) | ||
mug185 | NP_593763.1 | DnaJ | 9..71 | CDD:278647 | 26/61 (43%) |
zf-C2H2_2 | <260..314 | CDD:289522 | |||
zf-C2H2_jaz | 272..295 | CDD:288983 | |||
C2H2 Zn finger | 272..294 | CDD:275371 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |