DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and mug185

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_593763.1 Gene:mug185 / 2542938 PomBaseID:SPAC6B12.08 Length:380 Species:Schizosaccharomyces pombe


Alignment Length:233 Identity:60/233 - (25%)
Similarity:100/233 - (42%) Gaps:42/233 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 MSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLYDK 90
            |..|:.|.:.......||||.|.||::.||||||.|.|:..:.|.:||.||.||.|...|:.::|
pombe     8 MDCYEILQVNHDSDLQEIKANYRKLALQYHPDRNPGIEDYNEIFSQINAAYNILSNDDKRKWHEK 72

  Fly    91 GIVHTAGAQYAQDVHDVAEPV-----VEDDAETKFYKSRFQKSRVSDSA------GRT------- 137
            ..:..   ||:..:.||.:.:     :..::.:.|.:...|..:::.|.      |.|       
pombe    73 DYLRN---QYSVQIEDVLQHLQTIEKIPFESTSAFVERLRQDEKIAGSTDDLPTLGDTTWLWTYA 134

  Fly   138 -PIYDFDEWSRNHYGKSFDRRQAAQAKY-DRIKVQRETNRISGQTDMVLLAFIFAGVAVYLMFLA 200
             |||  .:|.|....|||:    .:|.| :..:....|.|:..:.:...:.:........:..|.
pombe   135 KPIY--QKWLRFSTKKSFE----WEALYNEEEESDAATRRLMKRQNQRQIQYCIQRYNELVRDLI 193

  Fly   201 ESSYD-TPKQK------AKERYR------RDQEEREQK 225
            ..:.| .|::|      ..|||.      |.|.||:::
pombe   194 GKACDLDPRRKNVVKLSDGERYNSLQEASRKQSERDRR 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 27/62 (44%)
DnaJ 27..89 CDD:278647 26/61 (43%)
mug185NP_593763.1 DnaJ 9..71 CDD:278647 26/61 (43%)
zf-C2H2_2 <260..314 CDD:289522
zf-C2H2_jaz 272..295 CDD:288983
C2H2 Zn finger 272..294 CDD:275371
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.