DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and SPAC2E1P5.03

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_594141.1 Gene:SPAC2E1P5.03 / 2541520 PomBaseID:SPAC2E1P5.03 Length:303 Species:Schizosaccharomyces pombe


Alignment Length:118 Identity:31/118 - (26%)
Similarity:47/118 - (39%) Gaps:39/118 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLLLRGLYLS------------------QRHQMSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDR 58
            ||||.|:.|:                  .:::.:.|:.|.:..:.:..||..||.|.|:|||||:
pombe     7 LLLLFGVCLAWTSSDLEIFRVVDSLKSILKNKATFYELLEVPTKASIKEINRAYRKKSILYHPDK 71

  Fly    59 NQGSENAAKKFREINQAYEILG-------NYRLRRLYD----KGIVHTAGAQY 100
            |..|:          :.|.:||       |...|:.||    .|.....|..|
pombe    72 NPKSK----------ELYTLLGLIVNILRNTETRKRYDYFLKNGFPRWKGTGY 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 20/69 (29%)
DnaJ 27..89 CDD:278647 20/68 (29%)
SPAC2E1P5.03NP_594141.1 CbpA 34..261 CDD:225124 25/91 (27%)
DnaJ 40..99 CDD:278647 20/68 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.