DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG11035 and SPBC543.02c

DIOPT Version :9

Sequence 1:	NP_001303469.1	Gene:	CG11035 / 40953	FlyBaseID:	FBgn0037544	Length:	231	Species:	Drosophila melanogaster
Sequence 2:	NP_596790.1	Gene:	SPBC543.02c / 2541066	PomBaseID:	SPBC543.02c	Length:	476	Species:	Schizosaccharomyces pombe

Alignment Length:	75	Identity:	31/75 - (41%)
Similarity:	48/75 - (64%)	Gaps:	0/75 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly    18 LYLSQRHQMSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNY 82
            |.|.:..:..||..||:.::.|..|||.||.||:::||||:|.|:..|..:|:|:.:||.||.:.
pombe   340 LELKKSKRKDHYKILGVSKEATDIEIKKAYRKLALVYHPDKNAGNLEAEARFKEVGEAYTILSDP 404

  Fly    83 RLRRLYDKGI 92
            ..||.:|.|:
pombe   405 ESRRRFDSGV 414

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG11035	NP_001303469.1	DnaJ	26..>89	CDD:223560	27/62 (44%)
CG11035	NP_001303469.1	DnaJ	27..89	CDD:278647	27/61 (44%)
SPBC543.02c	NP_596790.1	TPR_11	23..90	CDD:290150
		TPR repeat	23..51	CDD:276809
		TPR_1	29..52	CDD:278916
		TPR repeat	56..88	CDD:276809
		TPR repeat	93..117	CDD:276809
		TPR repeat	146..171	CDD:276809
		TPR_11	147..208	CDD:290150
		TPR_11	176..254	CDD:290150
		TPR_2	177..210	CDD:285020
		TPR repeat	177..205	CDD:276809
		TPR	227..256	CDD:197478
		TPR repeat	227..251	CDD:276809
		TPR repeat	256..290	CDD:276809
		TPR_11	261..325	CDD:290150
		TPR repeat	295..323	CDD:276809
		DnaJ	348..>430	CDD:223560	29/67 (43%)
		DnaJ	349..411	CDD:278647	27/61 (44%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910