DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and sec63

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_595985.1 Gene:sec63 / 2540961 PomBaseID:SPBC36B7.03 Length:611 Species:Schizosaccharomyces pombe


Alignment Length:225 Identity:45/225 - (20%)
Similarity:80/225 - (35%) Gaps:75/225 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 YDALGIRRQCTQNEIKAAYYKLSMLYHPDR-----NQGSENAAKKFREINQAYEILGNYRLRRLY 88
            |:.|||.:..:.::::..|.:||:.:|||:     |...|...|.:.||..||..|.:.:.|..|
pombe   100 YEILGIAKGTSVDDVRRHYKRLSIKFHPDKVRNMVNTTREEVEKHYIEITNAYRALTDDKTRENY 164

  Fly    89 ------------------DKGIVHTAGAQYAQDVHDVAEPVVEDDAETK-FYKSR-FQKSRVSDS 133
                              .|.|..:..:.|....:.:...:|...|..| :|.|| :.:..|.  
pombe   165 ALYGTPDVPQHISVGIALPKWISESENSIYILGFYGLVFGIVLPYAVGKWWYGSRTYTRDHVH-- 227

  Fly   134 AGRTPIYDFDEWSRNHYGKSFDRRQA-----------AQAK--------------------YDRI 167
                 :...|||        |.:.:.           |.:|                    :|.:
pombe   228 -----VDTVDEW--------FPKMETSLTLDELLSLFASSKELTSLVPNEKNPKEYILKLLFDHL 279

  Fly   168 KVQR----ETNRISGQTDMVLLAFIFAGVA 193
            ..::    .|::|..|:|:||.|.:....|
pombe   280 NRKKTNNFNTHQILSQSDVVLNALLSVATA 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 20/82 (24%)
DnaJ 27..89 CDD:278647 20/82 (24%)
sec63NP_595985.1 SEC63 1..611 CDD:227694 45/225 (20%)
DnaJ 98..164 CDD:278647 19/63 (30%)
Sec63 229..541 CDD:214946 15/89 (17%)
Nro1 <543..>599 CDD:289519
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.