DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and mug184

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_595124.1 Gene:mug184 / 2540016 PomBaseID:SPBC1773.09c Length:551 Species:Schizosaccharomyces pombe


Alignment Length:169 Identity:45/169 - (26%)
Similarity:77/169 - (45%) Gaps:24/169 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 MSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQG-SENAAKKFREINQAYEILGNYRLRRLYD 89
            :.:|..|.:::..|..:|:..|..|::.||||||.| .|.|.|:|:.:..|:|:|.:...|.:||
pombe    11 VDYYAILKLQKNATFQQIRKQYLFLALQYHPDRNPGDEERAVKRFQRLQLAHEVLSDATKRLIYD 75

  Fly    90 K--GIVHTAGAQYAQDVHDVAEPVVEDDAETKFYKSRFQK-SRVSDSAGRTPIYDFDEWS----- 146
            :  |:.....:||..  :..:.|.....|...:.|.:..| |....|..:.|....:::|     
pombe    76 QLFGLSTRTRSQYKP--NSTSNPSKHTSAYASYNKGKNSKWSSPFASTTKKPQESSEKYSKKSST 138

  Fly   147 --RNHYGK--SFDR----RQAAQAKYD-----RIKVQRE 172
              :.|:.|  ||.|    ......|||     .|:|:|:
pombe   139 RKKEHFNKKPSFPRDTEYSHIYNMKYDPRSGIGIRVKRQ 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 21/63 (33%)
DnaJ 27..89 CDD:278647 21/62 (34%)
mug184NP_595124.1 DnaJ 11..>79 CDD:223560 23/67 (34%)
DnaJ 12..75 CDD:278647 21/62 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.