DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and cwf23

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_587857.2 Gene:cwf23 / 2539268 PomBaseID:SPCC10H11.02 Length:289 Species:Schizosaccharomyces pombe


Alignment Length:281 Identity:58/281 - (20%)
Similarity:102/281 - (36%) Gaps:77/281 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SQRHQMSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLR 85
            |:...:.:|:.|||.......||..|:.|.|:.||||:|.....||:||..:..||..|.:.:||
pombe     3 SEGDSIDYYELLGINEDAQDQEIHRAWRKTSLKYHPDKNPNDPKAAEKFHMLQLAYNALIDVQLR 67

  Fly    86 RLYDKGIVHTAGAQYAQDVHDVAEPVVEDD---AETKFYKSRFQKSRVSDSAGRTPIYDFDEWSR 147
            :.||.........:..::..:.....:.||   .|.:||.|..:|....|.. :..:....|.|.
pombe    68 KAYDSERFAKLARKRREEAFNFQRKSMVDDLRERERQFYDSLEKKENERDRL-QEKLRALQEESA 131

  Fly   148 NHYGKSFDRRQAAQAKYDRIKVQRETNRIS---------------GQTDMVLLAFIFAGVA---- 193
            |...:..:|.:..|.:..|.|.:..:::||               .|.:...|..|::...    
pombe   132 NLRRQRENRLREEQEQSKRRKQETPSSKISELDRSIRIRWKRKYADQVNDAYLRSIYSSFGTLQN 196

  Fly   194 -------------VYLMFLAE---------------------------SSYDTPKQK-------- 210
                         ||.:.:.|                           |:.:||.:|        
pombe   197 VVIQKDISKEKKYVYSIIVFETLSSAYSAINAEKPSKIYDVQWLKPPKSNSNTPTEKDTTVEDYE 261

  Fly   211 ------AKERYRRDQEEREQK 225
                  .|:::::.|:|.|:|
pombe   262 EITIMRMKQKHKQKQKENERK 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 23/62 (37%)
DnaJ 27..89 CDD:278647 23/61 (38%)
cwf23NP_587857.2 DnaJ 9..71 CDD:278647 23/61 (38%)
DnaJ 9..>71 CDD:223560 23/61 (38%)
RRM_SF 165..240 CDD:302621 6/74 (8%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.