DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and Dnajb9

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:XP_038967719.1 Gene:Dnajb9 / 24908 RGDID:3070 Length:234 Species:Rattus norvegicus


Alignment Length:215 Identity:58/215 - (26%)
Similarity:97/215 - (45%) Gaps:55/215 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLLLRGLYLSQRHQMSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAY 76
            :|::..|.|:.:   ::||.||:.:..::.:||.|::||:|.||||:|: |.:|..|||||.:||
  Rat    26 ILMITELILASK---NYYDILGVPKSASERQIKKAFHKLAMKYHPDKNK-SPDAEAKFREIAEAY 86

  Fly    77 EILGNYRLRRLYDKGIVHTA----------GAQYAQDVHDVAEPVVED---------DAETKFYK 122
            |.|.:...|:.||. |.|:|          |:.:.|..:...:.:.:|         ....|.::
  Rat    87 ETLSDANRRKEYDI-IGHSAFTNGKGQRSNGSPFEQSFNFNFDDLFKDFNLFGQNQNTRSKKHFE 150

  Fly   123 SRFQKSRVSDSAGRTPIYDFDEWSRNHYGKSFD------------------RRQAAQ-------- 161
            :.||..:...|..|   :.|.|:|..  |..||                  .|:..|        
  Rat   151 NHFQTRQDGSSRQR---HHFQEFSFG--GGLFDDMFEDMEKMFSFSGFDSTNRRTVQTENRFHGS 210

  Fly   162 AKYDRIKVQRETNRISGQTD 181
            :|:.|...||..|.::..||
  Rat   211 SKHCRTVTQRRGNMVTTYTD 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 27/62 (44%)
DnaJ 27..89 CDD:278647 27/61 (44%)
Dnajb9XP_038967719.1 DnaJ 35..>147 CDD:223560 35/116 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.