DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and CG30156

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001260752.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster


Alignment Length:182 Identity:48/182 - (26%)
Similarity:80/182 - (43%) Gaps:35/182 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLYDKG 91
            :||:.|.|....|.:|:|.||:||::..|||:|: |..|.:.||.|::|.:.|.:.:.|..|:  
  Fly    96 NHYEVLRISHHATYSEVKRAYHKLALRLHPDKNK-SPGAEQAFRRISEAADCLTDCQKRIEYN-- 157

  Fly    92 IVHTAGAQYAQDVHDVAEPVVEDDAETKFYKSRFQKSRVSDSAGRTPIYDFDEWSRNHYGKSFDR 156
             :.||    ..|.||      :|.::.|.|:..               .:|:|.:.|..|.:|.|
  Fly   158 -IATA----VGDCHD------QDPSQYKDYRGE---------------SEFNEANGNDLGAAFRR 196

  Fly   157 --RQAAQAKYDRIKVQRETNRISGQTDMVLLAFI----FAGVAVYLMFLAES 202
              |.|.|....|..:.:....:.|....::..|:    .||...|...|..:
  Fly   197 PYRGANQRMPQRQSLYQTQQLVIGVVAALVFLFVTMHFIAGAPAYSFTLTRT 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 23/61 (38%)
DnaJ 27..89 CDD:278647 23/61 (38%)
CG30156NP_001260752.1 DnaJ 96..157 CDD:278647 23/61 (38%)
DUF1977 237..334 CDD:286411 3/12 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.