DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and Dnajb6

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001365764.1 Gene:Dnajb6 / 23950 MGIID:1344381 Length:372 Species:Mus musculus


Alignment Length:152 Identity:42/152 - (27%)
Similarity:71/152 - (46%) Gaps:32/152 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 MSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRN-QGSENAAKKFREINQAYEILGNYRLRRLYD 89
            :.:|:.||::|..:..:||.||.|.::.:|||:| :..|.|.:||:::.:|||:|.:.:.|.:||
Mouse     2 VDYYEVLGVQRHASPEDIKKAYRKQALKWHPDKNPENKEEAERKFKQVAEAYEVLSDAKKRDIYD 66

  Fly    90 K-GIVHTAGAQYAQDVH---------DVAEPVVEDDAETKFYKSRFQKSRVSDSAGRTPI-YD-- 141
            | |.....|......:|         ....|   ||...:|:            .||.|. :|  
Mouse    67 KYGKEGLNGGGGGGGIHFDSPFEFGFTFRNP---DDVFREFF------------GGRDPFSFDFF 116

  Fly   142 ---FDEWSRNHYGKSFDRRQAA 160
               ||::..|..|...:|.:.|
Mouse   117 EDPFDDFFGNRRGPRGNRSRGA 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 22/63 (35%)
DnaJ 27..89 CDD:278647 22/62 (35%)
Dnajb6NP_001365764.1 Interaction with HSP70. /evidence=ECO:0000250 1..147 42/152 (28%)
DnaJ 2..>138 CDD:223560 41/150 (27%)
Interaction with KRT18. /evidence=ECO:0000250 120..235 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.