DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and DNAJC8

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_055095.2 Gene:DNAJC8 / 22826 HGNCID:15470 Length:253 Species:Homo sapiens


Alignment Length:164 Identity:40/164 - (24%)
Similarity:78/164 - (47%) Gaps:19/164 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SQRHQMSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQ-GSENAAKKFREINQAYE-ILGNYR 83
            |....::.::.|.|..:.|..|||..:.:||:|.|||:|| .::.|.|.|..:::||: :|...:
Human    51 SSYFNLNPFEVLQIDPEVTDEEIKKRFRQLSILVHPDKNQDDADRAQKAFEAVDKAYKLLLDQEQ 115

  Fly    84 LRRLYDKGIVHTAGAQYAQDVHDVAE----------PVVEDDAETKFYKSRFQKSRVSDSAGRTP 138
            .:|..|   |..||.:|.:  |.|.|          |.:.::.:.:.:|....|..:...| ...
Human   116 KKRALD---VIQAGKEYVE--HTVKERKKQLKKEGKPTIVEEDDPELFKQAVYKQTMKLFA-ELE 174

  Fly   139 IYDFDEWSRNHYGKSFDRRQAAQAKYDRIKVQRE 172
            |...:..::..:.:...|.:..:|: ::.|.:||
Human   175 IKRKEREAKEMHERKRQREEEIEAQ-EKAKRERE 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 21/64 (33%)
DnaJ 27..89 CDD:278647 21/63 (33%)
DNAJC8NP_055095.2 CbpA 51..>238 CDD:225124 40/164 (24%)
DnaJ 57..112 CDD:99751 19/54 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 181..253 5/28 (18%)
Nuclear localization signal. /evidence=ECO:0000305|PubMed:27133716 189..192 0/2 (0%)
Nuclear localization signal. /evidence=ECO:0000305|PubMed:27133716 203..206 1/2 (50%)
Essential for polyglutamine aggregation suppression. /evidence=ECO:0000269|PubMed:27133716 232..253
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.