DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and Dnajc16

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_758841.1 Gene:Dnajc16 / 214063 MGIID:2442146 Length:772 Species:Mus musculus


Alignment Length:160 Identity:48/160 - (30%)
Similarity:74/160 - (46%) Gaps:33/160 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 WRPLLLLRGLYLSQRHQMSH--YDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQ--GSENAAKKF 69
            ||.|::| .|.|.....:..  |..||:.|..:|.:||.||.||:..:|||:|:  |:|:   :|
Mouse    10 WRFLMVL-VLILQSLSALDFDPYRVLGVSRTASQADIKKAYKKLAREWHPDKNKDPGAED---RF 70

  Fly    70 REINQAYEILGNYRLRRLYDKGIVHTAGAQYAQDVHDVAEPVVEDDAETKFYKSRFQKSRVSDSA 134
            .:|::|||||.|...|..||         .|.            |..|.:.|:.:.::.|.....
Mouse    71 IQISKAYEILSNEEKRTNYD---------HYG------------DAGENQGYQKQQREHRFRHFH 114

  Fly   135 GRTPIYDFDEWSRNHYGKSFDRRQAAQAKY 164
            ..   :.||| |..|:..:.:||.:...||
Mouse   115 EN---FYFDE-SFFHFPFNAERRDSGDEKY 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 26/66 (39%)
DnaJ 27..89 CDD:278647 26/65 (40%)
Dnajc16NP_758841.1 DnaJ 29..>135 CDD:223560 40/133 (30%)
TRX_DnaJ 134..243 CDD:239261 2/7 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 560..591
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.