DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and DNAJC18

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_689899.1 Gene:DNAJC18 / 202052 HGNCID:28429 Length:358 Species:Homo sapiens


Alignment Length:190 Identity:44/190 - (23%)
Similarity:76/190 - (40%) Gaps:38/190 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLY--- 88
            ::|:.||:.|..:..|:|.||.||::.:|||:| .:..|...|:.|..|:.:|.|...|..|   
Human    82 NYYEILGVSRDASDEELKKAYRKLALKFHPDKN-CAPGATDAFKAIGNAFAVLSNPDKRLRYDEY 145

  Fly    89 -DKGIVHTA-GAQYAQDVHDVAEPVVEDDAETKFYKSRFQK------SRVSDSAGRTPIYDFDEW 145
             |:.:..|| .|:......|....:..::....|:...|..      |.|:|        |...:
Human   146 GDEQVTFTAPRARPYNYYRDFEADITPEELFNVFFGGHFPTGNIHMFSNVTD--------DTYYY 202

  Fly   146 SRNHYGKSFDRRQAAQAKYDRIKVQRETNRISGQTD-----MVLLAFIFAGVAVYLMFLA 200
            .|.|             :::|.:.|:|......||.     .:|...:...::|....||
Human   203 RRRH-------------RHERTQTQKEEEEEKPQTTYSAFIQLLPVLVIVIISVITQLLA 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 22/65 (34%)
DnaJ 27..89 CDD:278647 22/65 (34%)
DNAJC18NP_689899.1 DnaJ 82..143 CDD:278647 21/61 (34%)
DUF1977 250..350 CDD:286411 44/190 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.