DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and dnj-26

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_502326.1 Gene:dnj-26 / 178171 WormBaseID:WBGene00001044 Length:365 Species:Caenorhabditis elegans


Alignment Length:238 Identity:41/238 - (17%)
Similarity:88/238 - (36%) Gaps:49/238 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 YDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLYDKGIV 93
            |..|.:.::.:.:||:.|:.|.....|||:.: ..:|.:..:.:|.|:.:|.:...||.||....
 Worm    29 YKILNVDKKASPDEIRIAFRKRIREVHPDKCK-HPSATEASKVVNNAFSLLMDPAKRRQYDLQNA 92

  Fly    94 HTAG---------------AQYA---QDVHDVAEP----------VVEDDAETKFYKSRFQKSRV 130
            .|:.               .:|:   :..|..:||          ..:.|..:|.::|..||::.
 Worm    93 ETSNENLYKRCNRNKNQRKQEYSNTQRQNHKKSEPSNGKRNEQNSSFKQDHNSKNHQSNHQKTKN 157

  Fly   131 SDSAGRTPIYDFDEWSRNHY-----------GKSFDRRQAAQAKYDRIKVQRETNRISGQTDMVL 184
            ..|...:...:|:. :|..|           |.:.|........|...:.|::......:.:...
 Worm   158 KKSNPYSNQNNFNN-TRKDYREEKSGFSWNTGSADDYEDFVYRNYQSYQQQQQNQYARRRHEEYT 221

  Fly   185 LAFIFAGVAVYLMFLAESSYDTPKQKAKERYRRDQEEREQKLV 227
            ..|.::.        :.:.:.|..:...::......|:|:.||
 Worm   222 DGFKYSS--------SSNPHSTSNEPFHDKSHNSDVEKEEYLV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 15/59 (25%)
DnaJ 27..89 CDD:278647 15/59 (25%)
dnj-26NP_502326.1 DnaJ 27..88 CDD:365959 15/59 (25%)
DUF4887 <81..174 CDD:374444 16/93 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.