Sequence 1: | NP_001303469.1 | Gene: | CG11035 / 40953 | FlyBaseID: | FBgn0037544 | Length: | 231 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_502326.1 | Gene: | dnj-26 / 178171 | WormBaseID: | WBGene00001044 | Length: | 365 | Species: | Caenorhabditis elegans |
Alignment Length: | 238 | Identity: | 41/238 - (17%) |
---|---|---|---|
Similarity: | 88/238 - (36%) | Gaps: | 49/238 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 29 YDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLYDKGIV 93
Fly 94 HTAG---------------AQYA---QDVHDVAEP----------VVEDDAETKFYKSRFQKSRV 130
Fly 131 SDSAGRTPIYDFDEWSRNHY-----------GKSFDRRQAAQAKYDRIKVQRETNRISGQTDMVL 184
Fly 185 LAFIFAGVAVYLMFLAESSYDTPKQKAKERYRRDQEEREQKLV 227 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11035 | NP_001303469.1 | DnaJ | 26..>89 | CDD:223560 | 15/59 (25%) |
DnaJ | 27..89 | CDD:278647 | 15/59 (25%) | ||
dnj-26 | NP_502326.1 | DnaJ | 27..88 | CDD:365959 | 15/59 (25%) |
DUF4887 | <81..174 | CDD:374444 | 16/93 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |