Sequence 1: | NP_001303469.1 | Gene: | CG11035 / 40953 | FlyBaseID: | FBgn0037544 | Length: | 231 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_502122.1 | Gene: | dnj-1 / 178040 | WormBaseID: | WBGene00001019 | Length: | 401 | Species: | Caenorhabditis elegans |
Alignment Length: | 197 | Identity: | 44/197 - (22%) |
---|---|---|---|
Similarity: | 78/197 - (39%) | Gaps: | 40/197 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 RHQMSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRL 87
Fly 88 YDK-----GIVHTA---------GAQYAQD-VHDVAEPVVEDDAETKFYKSRFQKSRVSDSAGRT 137
Fly 138 PIYDFDEWSRNHYGKSFDRRQAAQAKYDRIKVQRETNRISGQTDMVLLAFIFAGVAVYLMFLAES 202
Fly 203 SY 204 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11035 | NP_001303469.1 | DnaJ | 26..>89 | CDD:223560 | 17/62 (27%) |
DnaJ | 27..89 | CDD:278647 | 17/61 (28%) | ||
dnj-1 | NP_502122.1 | DnaJ | 137..>260 | CDD:333066 | 29/145 (20%) |
DUF1977 | 300..397 | CDD:312722 | 2/5 (40%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |