DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and dnj-1

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_502122.1 Gene:dnj-1 / 178040 WormBaseID:WBGene00001019 Length:401 Species:Caenorhabditis elegans


Alignment Length:197 Identity:44/197 - (22%)
Similarity:78/197 - (39%) Gaps:40/197 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RHQMSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRL 87
            ||...:|:.|.|.::.:.::|:..|.||::..|||:.: :.:|.:.|:.:..||.:|.:...||.
 Worm   133 RHCKDYYEILKIDKKASDDDIRKEYRKLALKLHPDKCR-APHATEAFKALGNAYAVLSDTDKRRQ 196

  Fly    88 YDK-----GIVHTA---------GAQYAQD-VHDVAEPVVEDDAETKFYKSRFQKSRVSDSAGRT 137
            ||:     ...||.         ||.:..| .|........::....|:...|...:|...|   
 Worm   197 YDQYGAEAANSHTPTTRRRGGGHGAFFEHDYAHGFEAEFTPEEIFNMFFGGGFPTEQVRRRA--- 258

  Fly   138 PIYDFDEWSRNHYGKSFDRRQAAQAKYDRIKVQRETNRISGQTDMVLLAFIFAGVAVYLMFLAES 202
                               |.|.|.:|...:.|:.......|. :.|:|.:..|:...|| :.|.
 Worm   259 -------------------RYAQQQQYHHYEQQQSPYGPLLQL-LPLIAIMVIGLLAQLM-VGEP 302

  Fly   203 SY 204
            :|
 Worm   303 AY 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 17/62 (27%)
DnaJ 27..89 CDD:278647 17/61 (28%)
dnj-1NP_502122.1 DnaJ 137..>260 CDD:333066 29/145 (20%)
DUF1977 300..397 CDD:312722 2/5 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.