DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and F54F2.9

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_498949.2 Gene:F54F2.9 / 176241 WormBaseID:WBGene00018836 Length:414 Species:Caenorhabditis elegans


Alignment Length:212 Identity:51/212 - (24%)
Similarity:83/212 - (39%) Gaps:75/212 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 MSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLYDK 90
            ::.|:...|.|..:.|::|.||.||::.:||||| .:.:|.:|||::...||:|....||..||.
 Worm    34 VNFYEWFDIPRDASSNQVKKAYRKLTLEWHPDRN-SAPDATEKFRQVAGIYEVLKTTELREKYDN 97

  Fly    91 GIVHTAGAQYAQDVHDVAEPVVEDDAETKFYKSRFQKSRVSDSAGRTPIYDFDEWSRNHYGKSFD 155
                                |:|:..                .:.|.|:|             :.
 Worm    98 --------------------VLENGL----------------PSWRHPMY-------------YY 113

  Fly   156 RRQAAQAKYDRIKVQRETNRISGQTDMVLLAFIFAG-VAVYLMFLA---ESS--YDTPKQKAKER 214
            ||....|.|:.|                 |..:|.| :|.|||..|   |.:  |....:|:::.
 Worm   114 RRMRKLAWYEGI-----------------LVLLFIGTIAHYLMMWAAYFEKTLVYKQNVKKSRKS 161

  Fly   215 YRRDQEEREQKLVGKQS 231
            .:.|..|.|:.:  ||:
 Worm   162 KKEDPAEAEKLM--KQA 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 23/62 (37%)
DnaJ 27..89 CDD:278647 23/61 (38%)
F54F2.9NP_498949.2 DnaJ 35..96 CDD:278647 23/61 (38%)
SANT 357..402 CDD:238096
SANT 357..402 CDD:197842
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.