DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and dnj-10

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_498902.1 Gene:dnj-10 / 176211 WormBaseID:WBGene00001028 Length:456 Species:Caenorhabditis elegans


Alignment Length:176 Identity:42/176 - (23%)
Similarity:72/176 - (40%) Gaps:43/176 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LSQRHQMS---HYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGN 81
            |...|.:|   :|..||:.::.....||.||::|:..||||.|:..| |..||:||::|||:|.:
 Worm    34 LHTTHALSKEDYYKTLGVDKKSDAKAIKKAYFQLAKKYHPDVNKTKE-AQTKFQEISEAYEVLSD 97

  Fly    82 YRLRRLYDK---------------GIVHTAGAQYAQDVHDVAEPVVEDDAETKFYKSRFQKSRVS 131
            ...|:.||.               |..|....    ||:::..                   |..
 Worm    98 DTKRQEYDAYGSGGGPAGGRGGAGGFHHHGNV----DVNEIFR-------------------RAF 139

  Fly   132 DSAGRTPIYDFDEWSRNHYGKSFDRRQAAQAKYDRIKVQRETNRIS 177
            ...|....::||.::::.:|.|..:.......::. .|:..|..:|
 Worm   140 GGGGGMGGFNFDNFAQSAFGHSAAQEMVMDISFEE-AVRGATKNVS 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 25/65 (38%)
DnaJ 27..89 CDD:278647 25/64 (39%)
dnj-10NP_498902.1 DnaJ 41..387 CDD:223560 40/169 (24%)
DnaJ 44..105 CDD:278647 24/61 (39%)
DnaJ_C 165..372 CDD:199909 3/21 (14%)
DnaJ_zf 191..252 CDD:199908
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.