DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and dnj-18

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_497962.1 Gene:dnj-18 / 175616 WormBaseID:WBGene00001036 Length:249 Species:Caenorhabditis elegans


Alignment Length:224 Identity:63/224 - (28%)
Similarity:96/224 - (42%) Gaps:50/224 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RGLYLSQ--RHQMSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRN-QGSENAAKKFREINQAYE 77
            |.|:||.  ..|..||..||:.:..:|.:||:||||||..:|||.| ...|.|||||.::..|||
 Worm    11 RSLFLSVPCSSQQDHYKVLGLAQSASQKDIKSAYYKLSKQHHPDTNPTNKEEAAKKFHQVAMAYE 75

  Fly    78 ILGNYRLRRLYDKGIVHTAGAQYAQDVHDVAEPVVEDDAETKFYKSRFQKSRVSDSAGRTPIYDF 142
            ||.:...|:.||...:.|:             |:..|.:.   :.:|:::...|:....|.| |.
 Worm    76 ILSSEDKRKAYDMTRIRTS-------------PMPNDPSS---FSNRYRRRTSSNLKQYTDI-DI 123

  Fly   143 DEWSRNHYGKSFDRRQAAQAKYDRIKVQRETNRISGQTDMVLLAFIFAGVAVYLMFLAESSYDTP 207
            |.....|:.:|..||....:.:|.      .|....:         |.|   :...:.:|.|:..
 Worm   124 DYKDFEHFQRSTRRRPQYHSHFDM------PNEFYAE---------FGG---FKKRVFKSEYEEA 170

  Fly   208 KQKAKERYR------------RDQEEREQ 224
            ::|....|:            |.|.||||
 Worm   171 QEKHGSMYKDGRAAQREMEELRRQVEREQ 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 29/63 (46%)
DnaJ 27..89 CDD:278647 29/62 (47%)
dnj-18NP_497962.1 PRK14300 23..>181 CDD:172788 52/192 (27%)
DnaJ 23..>88 CDD:223560 30/64 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I3884
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4983
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.