DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and dnj-23

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_495944.1 Gene:dnj-23 / 174451 WormBaseID:WBGene00001041 Length:242 Species:Caenorhabditis elegans


Alignment Length:238 Identity:57/238 - (23%)
Similarity:105/238 - (44%) Gaps:63/238 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 YDALGIRRQCTQNEIKAAYYKLSMLYHPDRN----QGSENAAKKFREINQAYEILGNYRLRRLYD 89
            |:.||:::.|.:..:|..||:.||.:|||::    :..:....||:.:|:||:||.:...|::||
 Worm    16 YELLGVKKDCDEKALKKGYYRQSMRWHPDKSNLVEEDMQTYTTKFQLLNKAYQILSDEEKRKIYD 80

  Fly    90 K-GIVHTAGAQYAQDV----HDVAEPVVEDDAET--KFYK-SRFQKSRV--------SDSAG-RT 137
            : |.|.....:..:|.    ..:.:.|.::|.::  |.|: ||.||..:        .|.|. |.
 Worm    81 ETGSVDDEAGELNEDALKAWRMIFKKVTKEDIDSFMKTYQGSREQKDELVVHYEKFNGDIAKIRE 145

  Fly   138 PIYDFD------------------EWSRNHYGKSFDRRQAA---QAKYDRIKVQRETNRISGQTD 181
            ....||                  |.::.:...:.|::..|   :|:.:.|:|:   |.....:|
 Worm   146 YAIGFDGVEELKEALDKLIDDGEIEKTKKYETSTSDKKMKAYKRKAEKEAIEVE---NMTQNNSD 207

  Fly   182 MVLL----------AFIFAGVAVYLMFLAESSYDTPKQKAKER 214
            :|.|          :|:.:..|.|    |.||    .:|||.:
 Worm   208 LVALIQGRQKERGTSFLDSLAAKY----APSS----SKKAKRQ 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 20/63 (32%)
DnaJ 27..89 CDD:278647 20/63 (32%)
dnj-23NP_495944.1 DnaJ 14..80 CDD:365959 20/63 (32%)
CbpA 15..240 CDD:225124 55/234 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.