DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG11035 and dnj-12

DIOPT Version :9

Sequence 1:	NP_001303469.1	Gene:	CG11035 / 40953	FlyBaseID:	FBgn0037544	Length:	231	Species:	Drosophila melanogaster
Sequence 2:	NP_493570.1	Gene:	dnj-12 / 173341	WormBaseID:	WBGene00001030	Length:	402	Species:	Caenorhabditis elegans

Alignment Length:	139	Identity:	39/139 - (28%)
Similarity:	70/139 - (50%)	Gaps:	37/139 - (26%)

- Green bases have known domain annotations that are detailed below.

  Fly    25 QMSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLYD 89
            :..:||.||::...:.||:|.||.|:::.:|||:|   .:.|::|::|:||||:|.:.:.|::||
Worm     4 ETGYYDVLGVKPDASDNELKKAYRKMALKFHPDKN---PDGAEQFKQISQAYEVLSDEKKRQIYD 65

  Fly    90 KGIVHTAGAQYAQ-------------DVHDV--------------AEPVVEDDAET--KFYKSRF 125
            :|     |.:..|             ||.|:              .:|.|.:...|  ..||...
Worm    66 QG-----GEEALQGGGGGGEGFHNPFDVFDMFFGGGGRGGRGERRVKPTVHNLRVTLDTLYKGVT 125

  Fly   126 QKSRVSDSA 134
            :|.::|.:|
Worm   126 KKLKISRTA 134

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG11035	NP_001303469.1	DnaJ	26..>89	CDD:223560	23/62 (37%)
CG11035	NP_001303469.1	DnaJ	27..89	CDD:278647	23/61 (38%)
dnj-12	NP_493570.1	PTZ00037	2..401	CDD:240236	39/139 (28%)
		DnaJ	7..65	CDD:278647	23/60 (38%)
		DnaJ_zf	136..201	CDD:199908
		DnaJ_C	200..334	CDD:199909
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	2	1.910