DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG11035 and dnj-27

DIOPT Version :9

Sequence 1:	NP_001303469.1	Gene:	CG11035 / 40953	FlyBaseID:	FBgn0037544	Length:	231	Species:	Drosophila melanogaster
Sequence 2:	NP_001040704.1	Gene:	dnj-27 / 173065	WormBaseID:	WBGene00001045	Length:	788	Species:	Caenorhabditis elegans

Alignment Length:	131	Identity:	42/131 - (32%)
Similarity:	65/131 - (49%)	Gaps:	17/131 - (12%)

- Green bases have known domain annotations that are detailed below.

  Fly    28 HYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLYD--- 89
            :|:.||:.|......|:.|:.||::..|||||....||..:|.:||:|||:|.:..||:.||
Worm    21 YYELLGVERDADDRTIRKAFKKLAIKKHPDRNTDDPNAHDEFVKINKAYEVLKDENLRKKYDQFG 85

  Fly    90 -KGIV--HTAGAQY-AQDVHDVAEPVVEDDAE-TKFYKSRFQKSRVSDSAGRTPIYDFDEWSRNH 149
             ||:.  ...|..| :...::....:.:||.| ....::.||: .||||.        :.|..|.
Worm    86 EKGLEDGFQGGNNYQSWQFYNDNFGIYDDDQEIVTLNRADFQR-MVSDSN--------EIWFINF 141

  Fly   150 Y 150
            |
Worm   142 Y 142

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG11035	NP_001303469.1	DnaJ	26..>89	CDD:223560	24/60 (40%)
CG11035	NP_001303469.1	DnaJ	27..89	CDD:278647	24/60 (40%)
dnj-27	NP_001040704.1	DnaJ	18..>150	CDD:223560	42/131 (32%)
		DnaJ	20..82	CDD:278647	24/60 (40%)
		PDI_a_ERdj5_N	116..214	CDD:239301	10/36 (28%)
		Thioredoxin_like	222..>312	CDD:294274
		ER_PDI_fam	438..750	CDD:273457
		PDI_a_ERdj5_C	438..543	CDD:239302
		PDI_a_ERdj5_C	549..664	CDD:239302
		PDI_a_ERdj5_C	670..773	CDD:239302
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910