DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and dnj-4

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_491558.1 Gene:dnj-4 / 172173 WormBaseID:WBGene00001022 Length:274 Species:Caenorhabditis elegans


Alignment Length:207 Identity:52/207 - (25%)
Similarity:88/207 - (42%) Gaps:43/207 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 WRPLLLLRGLYLSQR-------HQMSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAA 66
            |.|    .|.::.|.       .|.:||:.||:....|.:|||:|:|..|...||| |...|:|.
 Worm     7 WSP----HGFWVCQARFFNKKIRQRTHYEVLGVESTATLSEIKSAFYAQSKKVHPD-NSSEESAT 66

  Fly    67 KKFREINQAYEILGNYRLRRLYDKGIVHTAGAQYAQDVHDVAEPVVEDDAETKFYKSRFQKSRVS 131
            ..|.|:..||::|.....|||||..:....|.                      |.:..|:.:..
 Worm    67 ASFLELKNAYDVLRRPADRRLYDYQLRGGGGR----------------------YPNGGQRYQYP 109

  Fly   132 DSAGRTPIYDFD-EWSRNHYGKSFDRRQAAQAKYDRIKVQRETNRISGQTDMVLLAFI--FAGVA 193
            ::|   |.|||. :|| .::.::.|..::::.:.|  |..||..:...:...:.|..:  :.|..
 Worm   110 NTA---PQYDFSRDWS-TYWSQNPDNSRSSREERD--KSSREFMKSIVKWTAIGLVLVAGYNGGY 168

  Fly   194 VYLMFLAESSYD 205
            :||:...:...|
 Worm   169 LYLLAYNQKQLD 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 25/62 (40%)
DnaJ 27..89 CDD:278647 25/61 (41%)
dnj-4NP_491558.1 CbpA 27..>155 CDD:225124 42/156 (27%)
DnaJ 28..89 CDD:365959 25/61 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.