DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG11035 and Dnajb3

DIOPT Version :9

Sequence 1:	NP_001303469.1	Gene:	CG11035 / 40953	FlyBaseID:	FBgn0037544	Length:	231	Species:	Drosophila melanogaster
Sequence 2:	NP_032325.2	Gene:	Dnajb3 / 15504	MGIID:	1306822	Length:	242	Species:	Mus musculus

Alignment Length:	141	Identity:	44/141 - (31%)
Similarity:	67/141 - (47%)	Gaps:	29/141 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly    26 MSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRN-QGSENAAKKFREINQAYEILGNYRLRRLYD 89
            :.:|:.||:.||.:...|:.||.||::.:|||:| :..|.|.::|:::.||||:|.:.|.|.:||
Mouse     2 VDYYEVLGVPRQASAEAIRKAYRKLALKWHPDKNPEHKEEAERRFKQVAQAYEVLSDVRKREVYD 66

  Fly    90 K----GIVHTAGA---------QYAQDVHDVAEPVVE--------------DDAETKFYKSRFQK 127
            :    |.|...||         ||.....|.||...|              .|....|:..| :.
Mouse    67 RCGEVGEVGGGGAAGSPFHDAFQYVFSFRDPAEVFREFFGGHDPFSFDFFGGDPLENFFGDR-RS 130

  Fly   128 SRVSDSAGRTP 138
            :|.|.|.|..|
Mouse   131 TRGSRSRGAVP 141

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG11035	NP_001303469.1	DnaJ	26..>89	CDD:223560	24/63 (38%)
CG11035	NP_001303469.1	DnaJ	27..89	CDD:278647	24/62 (39%)
Dnajb3	NP_032325.2	DnaJ	3..66	CDD:278647	24/62 (39%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0714
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810