Sequence 1: | NP_001303469.1 | Gene: | CG11035 / 40953 | FlyBaseID: | FBgn0037544 | Length: | 231 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_660157.1 | Gene: | DNAJB7 / 150353 | HGNCID: | 24986 | Length: | 309 | Species: | Homo sapiens |
Alignment Length: | 197 | Identity: | 52/197 - (26%) |
---|---|---|---|
Similarity: | 88/197 - (44%) | Gaps: | 59/197 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 MSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRN-QGSENAAKKFREINQAYEILGNYRLRRLYD 89
Fly 90 K----GIVHTAGAQYAQDVHDVAEPVVEDDAETKFYKSRFQKSRVSDSAGRTPIYDFDEWS---- 146
Fly 147 -------RNHYGKSFDRRQAAQAKYDRIKVQRETNRISGQTDMVLLAFIFAGVAVYLMFLAESSY 204
Fly 205 DT 206 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11035 | NP_001303469.1 | DnaJ | 26..>89 | CDD:223560 | 24/63 (38%) |
DnaJ | 27..89 | CDD:278647 | 24/62 (39%) | ||
DNAJB7 | NP_660157.1 | DnaJ | 2..>101 | CDD:223560 | 35/117 (30%) |
DnaJ | 3..66 | CDD:278647 | 24/62 (39%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 282..309 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |