DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and DNAJB7

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_660157.1 Gene:DNAJB7 / 150353 HGNCID:24986 Length:309 Species:Homo sapiens


Alignment Length:197 Identity:52/197 - (26%)
Similarity:88/197 - (44%) Gaps:59/197 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 MSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRN-QGSENAAKKFREINQAYEILGNYRLRRLYD 89
            :.:|:.||::|..:..:||.||:|:::.:|||:| :..|.|.:||:|:.:|||:|.|...|.:||
Human     2 VDYYEVLGLQRYASPEDIKKAYHKVALKWHPDKNPENKEEAERKFKEVAEAYEVLSNDEKRDIYD 66

  Fly    90 K----GIVHTAGAQYAQDVHDVAEPVVEDDAETKFYKSRFQKSRVSDSAGRTPIYDFDEWS---- 146
            |    |: :..|:.:            :|:.|   |...|.|   .|...:...::.|.:|    
Human    67 KYGTEGL-NGGGSHF------------DDECE---YGFTFHK---PDDVFKEIFHERDPFSFHFF 112

  Fly   147 -------RNHYGKSFDRRQAAQAKYDRIKVQRETNRISGQTDMVLLAFIFAGVAVYLMFLAESSY 204
                   .|..|.|:..|                ||.:|        :.|:..:.|.:|...|||
Human   113 EDSLEDLLNRPGSSYGNR----------------NRDAG--------YFFSTASEYPIFEKFSSY 153

  Fly   205 DT 206
            ||
Human   154 DT 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 24/63 (38%)
DnaJ 27..89 CDD:278647 24/62 (39%)
DNAJB7NP_660157.1 DnaJ 2..>101 CDD:223560 35/117 (30%)
DnaJ 3..66 CDD:278647 24/62 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 282..309
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.