Sequence 1: | NP_001303469.1 | Gene: | CG11035 / 40953 | FlyBaseID: | FBgn0037544 | Length: | 231 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011512267.2 | Gene: | DNAJC21 / 134218 | HGNCID: | 27030 | Length: | 676 | Species: | Homo sapiens |
Alignment Length: | 260 | Identity: | 66/260 - (25%) |
---|---|---|---|
Similarity: | 111/260 - (42%) | Gaps: | 63/260 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 RHQMSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRN-QGSENAAKKFREINQAYEILGNYRLRR 86
Fly 87 LYD-------KG----------------IVHTAGAQYAQD-------VHDVAEPVVEDDAETKFY 121
Fly 122 KS-----RFQKSRVSDSAGRTPIYDFDEW-----SRNH-YGKSFDRRQAA----------QAKYD 165
Fly 166 RIKVQRETNRISGQTDMVLLAFI---FAGVAVYLMFLAESSYDTPKQKAKERYRRDQEEREQKLV 227
Fly 228 227 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11035 | NP_001303469.1 | DnaJ | 26..>89 | CDD:223560 | 25/63 (40%) |
DnaJ | 27..89 | CDD:278647 | 25/62 (40%) | ||
DNAJC21 | XP_011512267.2 | None |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |