DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and AgaP_AGAP001810

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:XP_321247.5 Gene:AgaP_AGAP001810 / 1281303 VectorBaseID:AGAP001810 Length:362 Species:Anopheles gambiae


Alignment Length:189 Identity:49/189 - (25%)
Similarity:81/189 - (42%) Gaps:26/189 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 HYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLYDKGI 92
            :|:.||:.:..|.::||.||.||::..|||:|. :..|.:.|:.|..|..||.:...||.||   
Mosquito   105 YYEVLGVAKDATDSDIKKAYKKLALQLHPDKNH-APGAVEAFKAIGNAVAILTDAEKRRSYD--- 165

  Fly    93 VHTAGAQYAQDVHDVAEPVVEDDAETKFYKSRFQKSRVSDSAGRTPIYDFDEWSRNHYGKSFDRR 157
                  .|..:.|.  :|.....|.   |...:..||     |....:..:|.....:|...:.:
Mosquito   166 ------LYGSEEHH--QPATARKAR---YHHDYAYSR-----GFETEFTAEELFNMFFGAEINTQ 214

  Fly   158 Q--AAQAKYDRIKVQRETNRISGQTDMVLLAFIFAGVAVYLM---FLAESSYD-TPKQK 210
            .  ..|.::.|.:.|:.....||....:.|..|...:|:.:|   |:::..|. ||.||
Mosquito   215 HVYTRQRRFHRAEQQQYREPQSGIAAFINLLPIILLIALSMMSSFFISDPIYSLTPSQK 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 22/60 (37%)
DnaJ 27..89 CDD:278647 22/60 (37%)
AgaP_AGAP001810XP_321247.5 DnaJ 103..>222 CDD:223560 35/136 (26%)
DnaJ 104..165 CDD:278647 22/60 (37%)
DUF1977 262..359 CDD:286411 5/12 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.