DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and AgaP_AGAP012194

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:XP_320338.4 Gene:AgaP_AGAP012194 / 1280492 VectorBaseID:AGAP012194 Length:259 Species:Anopheles gambiae


Alignment Length:166 Identity:47/166 - (28%)
Similarity:82/166 - (49%) Gaps:26/166 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 MSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGS-ENAAKKFREINQAYEILGNYRLRRLYD 89
            :.:|..|.:.|..|:.|||.||.||::.:|||:|..: |.:.::|:||::|||:|.:.:.||:||
Mosquito     2 VDYYKILDVSRTATEAEIKKAYKKLALRWHPDKNMDNPEESNRRFKEISEAYEVLSDEKKRRIYD 66

  Fly    90 K----GIVHTAGAQYAQDV----HDVAEPVVEDDAETKFYKSRFQKSRVSDSAGRTPIYDFDEWS 146
            :    |:::....:|.|..    |:.:..:  ||.|...:...|:              |.::..
Mosquito    67 QYGKDGLMNNGSDRYHQSTRHRRHNGSSGM--DDFEFFGFPFTFR--------------DPEDVF 115

  Fly   147 RNHYGKS-FDRRQAAQAKYDRIKVQRETNRISGQTD 181
            |..:|.| ||....:......|.|.|...|.:|.|:
Mosquito   116 REFFGGSPFDELFRSMFSLTHIHVLRHGRRANGATN 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 25/63 (40%)
DnaJ 27..89 CDD:278647 25/62 (40%)
AgaP_AGAP012194XP_320338.4 DnaJ 2..>124 CDD:223560 39/137 (28%)
DnaJ 3..66 CDD:278647 25/62 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.