DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG11035 and AgaP_AGAP008985

DIOPT Version :9

Sequence 1:	NP_001303469.1	Gene:	CG11035 / 40953	FlyBaseID:	FBgn0037544	Length:	231	Species:	Drosophila melanogaster
Sequence 2:	XP_319734.4	Gene:	AgaP_AGAP008985 / 1279947	VectorBaseID:	AGAP008985	Length:	474	Species:	Anopheles gambiae

Alignment Length:	101	Identity:	31/101 - (30%)
Similarity:	54/101 - (53%)	Gaps:	17/101 - (16%)

- Green bases have known domain annotations that are detailed below.

  Fly    14 LLRG--LYLSQRHQMSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAK-----KFRE 71
            |||.  ..|.:..:..:|..||:.:|.:::|||.||.|.::::||||:..:.:..|     ||:|
Mosquito   342 LLRDAKFQLKKSKRKDYYKILGVTKQASEDEIKKAYRKRALVHHPDRHANATDEEKKEQERKFKE 406

  Fly    72 INQAYEILGNYRLRRLYDKGIVHTAGAQYAQDVHDV 107
            :.:||.||.:...:..||.|          ||:.::
Mosquito   407 LGEAYTILSDPVKKSRYDSG----------QDLEEM 432

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG11035	NP_001303469.1	DnaJ	26..>89	CDD:223560	22/67 (33%)
CG11035	NP_001303469.1	DnaJ	27..89	CDD:278647	22/66 (33%)
AgaP_AGAP008985	XP_319734.4	TPR_11	4..69	CDD:290150
		TPR repeat	4..32	CDD:276809
		TPR repeat	37..67	CDD:276809
		TPR_11	38..103	CDD:290150
		TPR repeat	106..131	CDD:276809
		TPR repeat	156..180	CDD:276809
		TPR_11	185..263	CDD:290150
		TPR repeat	185..215	CDD:276809
		TPR repeat	265..299	CDD:276809
		TPR_11	269..334	CDD:290150
		TPR_1	270..303	CDD:278916
		TPR repeat	304..332	CDD:276809
		TPR	305..336	CDD:197478
		DnaJ	357..424	CDD:278647	22/66 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910