DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG11035 and AgaP_AGAP010239

DIOPT Version :9

Sequence 1:	NP_001303469.1	Gene:	CG11035 / 40953	FlyBaseID:	FBgn0037544	Length:	231	Species:	Drosophila melanogaster
Sequence 2:	XP_319428.4	Gene:	AgaP_AGAP010239 / 1279661	VectorBaseID:	AGAP010239	Length:	345	Species:	Anopheles gambiae

Alignment Length:	63	Identity:	30/63 - (47%)
Similarity:	44/63 - (69%)	Gaps:	1/63 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly    28 HYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLYDK 90
            :|..|||.|..|..:||.||.||::.||||:|: |..|.:||:|:.:|||:|.:.:.|.:|||
Mosquito     5 YYKTLGIPRGSTDEDIKKAYRKLALKYHPDKNK-SPGAEEKFKEVAEAYEVLSDKKKREMYDK 66

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG11035	NP_001303469.1	DnaJ	26..>89	CDD:223560	27/60 (45%)
CG11035	NP_001303469.1	DnaJ	27..89	CDD:278647	27/60 (45%)
AgaP_AGAP010239	XP_319428.4	DnaJ	1..338	CDD:223560	30/63 (48%)
		DnaJ	4..65	CDD:278647	27/60 (45%)
		DnaJ_C	166..330	CDD:199909
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0714
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810