DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and AgaP_AGAP010141

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:XP_319298.3 Gene:AgaP_AGAP010141 / 1279561 VectorBaseID:AGAP010141 Length:210 Species:Anopheles gambiae


Alignment Length:221 Identity:49/221 - (22%)
Similarity:86/221 - (38%) Gaps:47/221 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PLLLLRGLYLSQRHQMSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENA--AKKFREIN 73
            |:.:|...:....|: :||:.|.::..|:..:::.|:.:||...|||.|..::..  .|.|.|:.
Mosquito     7 PIYMLHIYHCRYTHR-THYNVLKLQPNCSARDVRTAFIQLSKELHPDANVSNQAKYDKKSFVELL 70

  Fly    74 QAYEILGNYRLRRLYDKGIVHTAGAQYAQDVHDVAEPVVEDDAETKFYKSRFQKSRVSDSAGRTP 138
            :||::|.....|..||                  .|..:..:...:.|.:....|.....|..|.
Mosquito    71 EAYKVLSKPESRAAYD------------------YELSLSKNPGNQVYVNLLTNSTYRPWAANTM 117

  Fly   139 IYDFDEWSRNHYGKSFDRRQAAQAKYDRIKVQRETNRISGQTDMVLLAFIFAGVAVYLMFLAESS 203
            .|..:|  :.:||               ||   ...::|..| :||...||..|.:.|..:|.:.
Mosquito   118 HYSNEE--QPYYG---------------IK---GVKKVSNWT-IVLCCGIFMLVGIVLQAVAINK 161

  Fly   204 YDTPKQKAKERYRRDQ-----EEREQ 224
            ..|.::...:.|.|..     |.||:
Mosquito   162 SFTFQRDQLDEYSRQNAITHAEVREE 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 18/64 (28%)
DnaJ 27..89 CDD:278647 18/63 (29%)
AgaP_AGAP010141XP_319298.3 DnaJ 22..86 CDD:278647 18/63 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.