DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and AgaP_AGAP008327

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:XP_317136.4 Gene:AgaP_AGAP008327 / 1277658 VectorBaseID:AGAP008327 Length:359 Species:Anopheles gambiae


Alignment Length:79 Identity:30/79 - (37%)
Similarity:51/79 - (64%) Gaps:3/79 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLLLRGLYLSQRHQMSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAY 76
            |||:....|:.|   ..|..||:|:..::|::|.||.||:...|||:|:...:|::||:::..||
Mosquito    17 LLLVADDALAGR---DFYKILGLRKTASKNDVKKAYRKLAKELHPDKNKDDPDASQKFQDLGAAY 78

  Fly    77 EILGNYRLRRLYDK 90
            |:|.:...|:|||:
Mosquito    79 EVLSDDDKRKLYDR 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 23/62 (37%)
DnaJ 27..89 CDD:278647 23/61 (38%)
AgaP_AGAP008327XP_317136.4 DnaJ 26..345 CDD:223560 26/70 (37%)
DnaJ 29..91 CDD:278647 23/61 (38%)
DnaJ_C 133..330 CDD:199909
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.