DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and AgaP_AGAP000831

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:XP_316797.3 Gene:AgaP_AGAP000831 / 1277341 VectorBaseID:AGAP000831 Length:341 Species:Anopheles gambiae


Alignment Length:253 Identity:49/253 - (19%)
Similarity:80/253 - (31%) Gaps:110/253 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GLYLSQRH--QMSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSEN---AAKKFREINQAY 76
            |.||...:  |.:.|:.||:.|:.|:.||..:|.:|:..||||.:.|.|.   |.:.|:.|..||
Mosquito    24 GHYLDSYYCGQDNCYELLGVSRESTKQEIAKSYRQLARKYHPDLHHGPEQKQAAEESFKRIATAY 88

  Fly    77 EILGNYRLRRLYDKGIVHTAGAQYAQDVHDVAEPVVEDDAETKFYKSRFQKSRVSDSAGRTPIYD 141
            |:|.                                                             
Mosquito    89 EVLK------------------------------------------------------------- 92

  Fly   142 FDEWSRNHYGKSFDRRQAAQAKYDRIKVQRETNRISGQTDMVLLAFIFAGVAVYLMFLAE-SSYD 205
             ||.|||.|....|..||..|.:.|.      .|...:.|:.|:..:...:...:.::.. ..||
Mosquito    93 -DEESRNDYNYLLDNPQAYYAHFYRY------YRRKAKIDVRLVIVVTISIISCIQYVTRWQRYD 150

  Fly   206 T--------PKQK----------------------------AKERYRRDQEEREQKLV 227
            |        ||.:                            :|...|::.:|:.:|::
Mosquito   151 TAIKYFMSLPKYRNKAMEMINQSNGGGGGGGGSGKQGRIKLSKAEQRKEHDEQIRKVI 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 22/65 (34%)
DnaJ 27..89 CDD:278647 22/64 (34%)
AgaP_AGAP000831XP_316797.3 DnaJ 36..101 CDD:278647 27/126 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.