DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG11035 and AgaP_AGAP005981

DIOPT Version :9

Sequence 1:	NP_001303469.1	Gene:	CG11035 / 40953	FlyBaseID:	FBgn0037544	Length:	231	Species:	Drosophila melanogaster
Sequence 2:	XP_316024.4	Gene:	AgaP_AGAP005981 / 1276654	VectorBaseID:	AGAP005981	Length:	400	Species:	Anopheles gambiae

Alignment Length:	63	Identity:	26/63 - (41%)
Similarity:	42/63 - (66%)	Gaps:	3/63 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly    29 YDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLYDKG 91
            ||.||::..|:..::|.||.||:|.||||:|   .|..::|:.|:.|||:|.:...:.:||:|
Mosquito     8 YDVLGVKPGCSPEDLKKAYRKLAMKYHPDKN---PNEGERFKAISMAYEVLSDPEKKAIYDEG 67

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG11035	NP_001303469.1	DnaJ	26..>89	CDD:223560	23/59 (39%)
CG11035	NP_001303469.1	DnaJ	27..89	CDD:278647	23/59 (39%)
AgaP_AGAP005981	XP_316024.4	PTZ00037	2..398	CDD:240236	26/63 (41%)
		DnaJ	7..65	CDD:278647	23/59 (39%)
		DnaJ_C	108..334	CDD:199909
		DnaJ_zf	136..202	CDD:199908
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910