DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and AgaP_AGAP002386

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:XP_312569.5 Gene:AgaP_AGAP002386 / 1273576 VectorBaseID:AGAP002386 Length:1078 Species:Anopheles gambiae


Alignment Length:277 Identity:54/277 - (19%)
Similarity:97/277 - (35%) Gaps:107/277 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 YDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQ--GSENAAKKFREINQAYEILGNYRLRRLYDKG 91
            |..||:...|:|.:|:..|.|:::|.|||:|:  |:|.|   |:.:.:::|::|....|:.||:.
Mosquito   822 YSILGVSPDCSQEQIRKHYKKIAVLVHPDKNKQPGAEEA---FKVLQRSFELIGEPESRKEYDQS 883

  Fly    92 IVHTAGAQYA-QDVHD--------------------------------------------VAEPV 111
            :.....|:.| .:::|                                            :..|.
Mosquito   884 LAEALNAEKAWSEINDLLTQLHTKISEAANTIRCSSCCLRHPRKPTGRAHYAARECSSCKIRHPA 948

  Fly   112 VEDD--AETKFYKSRFQKSRVSDSAGRTPIYDFDEWS------------RNH-------YGKSFD 155
            .|.|  |||.|...|::...:.:.    .:||..||:            .:|       .|.|..
Mosquito   949 REGDIWAETSFLGLRWKYLAMMEG----NVYDITEWANCQKGALSHLQPNSHIVQYRIVLGSSSQ 1009

  Fly   156 RRQAAQAKYDRIKVQRETNRISGQ---TDMV----------------LLAFIFAGVAVYLMFLAE 201
            ::|..|.:.     |.:....:||   .|.:                .|..|:||        ..
Mosquito  1010 QQQQQQQQQ-----QHQPQHQAGQPLDKDQIGRSRKEPTANEPNLDDFLNNIYAG--------QN 1061

  Fly   202 SSYDTPKQKAKERYRRD 218
            ....:....::.||||:
Mosquito  1062 QQASSQNASSRRRYRRN 1078

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 20/61 (33%)
DnaJ 27..89 CDD:278647 20/61 (33%)
AgaP_AGAP002386XP_312569.5 DnaJ 820..881 CDD:278647 20/61 (33%)
Jiv90 914..1003 CDD:291562 13/92 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.