DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG11035 and AgaP_AGAP007361

DIOPT Version :9

Sequence 1:	NP_001303469.1	Gene:	CG11035 / 40953	FlyBaseID:	FBgn0037544	Length:	231	Species:	Drosophila melanogaster
Sequence 2:	XP_308470.4	Gene:	AgaP_AGAP007361 / 1269820	VectorBaseID:	AGAP007361	Length:	785	Species:	Anopheles gambiae

Alignment Length:	70	Identity:	25/70 - (35%)
Similarity:	42/70 - (60%)	Gaps:	6/70 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly    24 HQMSH---YDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLR 85
            ::||:   |:.||:....:|.|||.||..||::.|||:..|.|   |.|.::.:||:.|.:...|
Mosquito    99 YEMSNFDPYEILGVPLGSSQKEIKKAYRTLSVILHPDKETGDE---KAFMKLTKAYQALTDDEAR 160

  Fly    86 RLYDK 90
            :.::|
Mosquito   161 KNWEK 165

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG11035	NP_001303469.1	DnaJ	26..>89	CDD:223560	24/65 (37%)
CG11035	NP_001303469.1	DnaJ	27..89	CDD:278647	23/64 (36%)
AgaP_AGAP007361	XP_308470.4	DnaJ	105..164	CDD:278647	22/61 (36%)
		Sec63	211..>480	CDD:304568
		Sec63	<639..734	CDD:304568
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910