DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and maff

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:XP_002934281.1 Gene:maff / 100488557 XenbaseID:XB-GENE-489964 Length:148 Species:Xenopus tropicalis


Alignment Length:102 Identity:19/102 - (18%)
Similarity:36/102 - (35%) Gaps:31/102 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 TPIYDFDEW------SRNHYGKSFDRRQAAQAKYDRIKVQRETNRISGQTDMVLLAFIFAGVAVY 195
            ||:...||.      ..||:.:...:.:..     |:|.:|.|.:..|                 
 Frog    21 TPLLSDDELMSMSVRELNHHLRGLSKEEVV-----RLKQRRRTLKNRG----------------- 63

  Fly   196 LMFLAESSYDTPKQKAK-ERYRRDQEEREQKLVGKQS 231
              :.|........||.: |:.::|.::..:||..:.|
 Frog    64 --YAASCRVKRVSQKEELEKQKKDLQQEVEKLAQENS 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560
DnaJ 27..89 CDD:278647
maffXP_002934281.1 bZIP_Maf_small 46..115 CDD:269865 13/77 (17%)
coiled coil 46..115 CDD:269865 13/77 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.