DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and dnajc30

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:XP_002933669.1 Gene:dnajc30 / 100488245 XenbaseID:XB-GENE-877324 Length:310 Species:Xenopus tropicalis


Alignment Length:159 Identity:56/159 - (35%)
Similarity:93/159 - (58%) Gaps:9/159 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LSQRHQMSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRL 84
            |..:.:.::||.||:....||.:||.||||.|..||||||.||:.|..:|.||::||.:||:..|
 Frog   131 LLYKSRTAYYDILGVTGNATQTQIKTAYYKQSFRYHPDRNAGSDEATSRFGEISEAYSVLGSVSL 195

  Fly    85 RRLYDKGIVHTAGAQYAQDVHDVAEPVVEDDAETKFYKS--RFQKSRVSDSAGRTPIYDFDEWSR 147
            |:.||:||:..      :||.:..:|..:..:.::...|  |.:.|..|.::...|:::|||:.:
 Frog   196 RKKYDRGILSW------EDVRNAGKPSGKASSPSRKATSPQRERSSSASSNSPSKPMFNFDEFYQ 254

  Fly   148 NHYGKSFDRRQAAQAKYDRI-KVQRETNR 175
            .|||:...|.|..:.:.|.| |::.:.:|
 Frog   255 AHYGEQLQREQFWRQRRDLIQKLKNQPSR 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 31/62 (50%)
DnaJ 27..89 CDD:278647 31/61 (51%)
dnajc30XP_002933669.1 DnaJ 139..200 CDD:365959 31/60 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 76 1.000 Domainoid score I8832
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1404041at2759
OrthoFinder 1 1.000 - - FOG0007820
OrthoInspector 1 1.000 - - oto102724
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4983
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.