DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and LOC100333185

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:XP_005172774.1 Gene:LOC100333185 / 100333185 -ID:- Length:328 Species:Danio rerio


Alignment Length:182 Identity:62/182 - (34%)
Similarity:95/182 - (52%) Gaps:25/182 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RHQMSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRL 87
            :.:.::||.|.:.:..|..:||.||||.|.:||||:|.|||:|..:|.:||:||.:|||..|||.
Zfish   162 KSKSAYYDILEVSQSATHAQIKTAYYKQSFIYHPDKNAGSEDATHRFSQINEAYSVLGNKELRRK 226

  Fly    88 YDKGIVHTAGAQYAQDVHDVAEPVVEDDAETKFYKSRFQKSRVSDSAG--RTPIYDFDEWSRNHY 150
            ||:||:..|      |:...:......::.....:||   :|.|.:.|  :..|:|||.:.:.||
Zfish   227 YDRGILSQA------DLRGSSRGAAGRESPASGQQSR---ARHSSTVGFSQQKIFDFDTFIKAHY 282

  Fly   151 G----KSFDRRQAAQAKYDRIKVQRETNRISGQTDMV--LLAFIFAGVAVYL 196
            |    |...|||..|...::...:.|        ||.  ::|.:..||.|.|
Zfish   283 GEQLQKEKQRRQRMQEMLEKDSKRSE--------DMKKDVMAEVILGVIVIL 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 31/62 (50%)
DnaJ 27..89 CDD:278647 31/61 (51%)
LOC100333185XP_005172774.1 DnaJ 162..>229 CDD:223560 32/66 (48%)
DnaJ 167..228 CDD:278647 31/60 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1404041at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.