DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and dnajc25

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001191956.1 Gene:dnajc25 / 100319235 ZFINID:ZDB-GENE-081104-137 Length:344 Species:Danio rerio


Alignment Length:246 Identity:55/246 - (22%)
Similarity:88/246 - (35%) Gaps:103/246 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLRGLYLSQRHQMSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQ------GSENAAKKFREI 72
            |:.|||...:   |.||.||:.|..::.|:..||.:|:..|||||.|      ..|:|.:||..:
Zfish    27 LIEGLYCGTQ---SCYDVLGVSRDVSKAELGRAYRQLARRYHPDRFQPGETDDTQESAQQKFLLV 88

  Fly    73 NQAYEILGNYRLRRLYDKGIVHTAGAQYAQDVHDVAEPVVEDDAETKFYKSRFQKSRVSDSAGRT 137
            ..|||.|.:..||:.||..:.|                      ..::|                
Zfish    89 ATAYETLKDEELRKDYDYMLDH----------------------PEEYY---------------- 115

  Fly   138 PIYDFDEWSRNHYGKSFDRRQAAQAKYDRIKVQRETNRISGQTDMVLLAFIFAGVAVYLMFLAES 202
                      :||...:.||.|     .::.|:           :|:|..|.| ::::..:...|
Zfish   116 ----------SHYYTYYRRRLA-----PKVDVR-----------IVILVTICA-ISLFQYYSWWS 153

  Fly   203 SY---------------------------DTPKQKAKERYRRDQ--EEREQ 224
            ||                           :..|:|.|.|..:::  ||.||
Zfish   154 SYTEAINYLMTVPKYRIQATELAKQQGLLNRTKEKGKNRRSKEEIREEEEQ 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 26/68 (38%)
DnaJ 27..89 CDD:278647 26/67 (39%)
dnajc25NP_001191956.1 DnaJ 37..105 CDD:278647 26/67 (39%)
DnaJ 39..>113 CDD:223560 28/95 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.