DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and dnajc8

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001120231.1 Gene:dnajc8 / 100145281 XenbaseID:XB-GENE-946546 Length:250 Species:Xenopus tropicalis


Alignment Length:207 Identity:47/207 - (22%)
Similarity:83/207 - (40%) Gaps:68/207 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SQRHQMSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGS-ENAAKKFREINQAYE-ILGNYR 83
            |....::.::.|.|..:.|..|:|..:.:||:|.|||:||.. :.|.|.|..:::||: :|...:
 Frog    48 SSYFNLNPFEVLQIDPEVTDEEVKKRFRQLSILVHPDKNQDDVDRAQKAFEAVDKAYKSLLDPEQ 112

  Fly    84 LRRLYDKGIVHTAGAQYAQDVHDVAEPVVEDDAETKFYKSRFQKSRVSDSAGRTPIYDFDEWSRN 148
            .:|..|   |..||.:|           ||..|:.|  |.:.:|.      |::.|.:.|     
 Frog   113 KKRALD---VIQAGYEY-----------VEHIAKEK--KKQLKKE------GKSVIVEED----- 150

  Fly   149 HYGKSFDRRQAAQAKYDRIKVQRETNRISGQTDMVLLAFIFAGVAVYLMFLAESSYDTPKQKAKE 213
                  |.....||.|      ::|.::..:.::                           |.||
 Frog   151 ------DPEVFKQAVY------KQTMKLFAELEI---------------------------KRKE 176

  Fly   214 RYRRDQEEREQK 225
            |..:|..||:::
 Frog   177 REAKDMHERKRQ 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 20/64 (31%)
DnaJ 27..89 CDD:278647 20/63 (32%)
dnajc8NP_001120231.1 CbpA 48..>221 CDD:225124 47/207 (23%)
DnaJ 54..112 CDD:197617 19/57 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.