DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and dnajc18

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001096348.1 Gene:dnajc18 / 100124938 XenbaseID:XB-GENE-5795683 Length:483 Species:Xenopus tropicalis


Alignment Length:201 Identity:47/201 - (23%)
Similarity:77/201 - (38%) Gaps:58/201 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 HYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLYDKGI 92
            :|..||:.:...:..::.||.||::.||||:| .|..|.:.|:.|.:|:.:|.:...|:.||   
 Frog   112 YYSLLGVSKDANEETVRKAYLKLALRYHPDKN-SSPGATETFKAIGKAFSVLSDPAQRKSYD--- 172

  Fly    93 VHTAGAQYAQDVHDVAEPVVEDDAETK-----FYKSRFQKSRVSDSAGRTPIYDFDEWSRNHYGK 152
                      |....|..|.:.|..|:     |:|..|            |.|.|.:  :....:
 Frog   173 ----------DAQAKARVVSQPDLTTEDLFDLFFKGHF------------PGYAFSQ--QYQQPR 213

  Fly   153 SFDRRQAAQAKYDRIKVQRETNRISGQTDMVLLAFIFAGVAVYLMFLAESSYDTPKQKAKERYRR 217
            |.:|||.     ||.:...|.....|:...                  ....||.:.:.:|  |:
 Frog   214 STNRRQG-----DRGQRWEEEEEEDGRQQW------------------RQGEDTRQDRGRE--RK 253

  Fly   218 DQEERE 223
            ..|||:
 Frog   254 WSEERQ 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 19/60 (32%)
DnaJ 27..89 CDD:278647 19/60 (32%)
dnajc18NP_001096348.1 DnaJ 111..172 CDD:306689 19/60 (32%)
Rho <213..>346 CDD:333130 15/72 (21%)
DUF1977 375..473 CDD:312722
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.