DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10903 and RID2

DIOPT Version :9

Sequence 1:NP_001262365.1 Gene:CG10903 / 40952 FlyBaseID:FBgn0037543 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_200538.1 Gene:RID2 / 835833 AraportID:AT5G57280 Length:289 Species:Arabidopsis thaliana


Alignment Length:289 Identity:151/289 - (52%)
Similarity:195/289 - (67%) Gaps:13/289 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARRPEHSAPPEIFYNDDEAKKYSTNTRIIEIQVEMAERALELLALPDDDESRLILDIGCGSGLS 65
            |:.|||..|||||||:|.||:||::::||:|||.:::||||||||||:|...|.:||||||||||
plant     1 MSNRPELLAPPEIFYDDTEARKYTSSSRIVEIQAKLSERALELLALPEDGVPRFLLDIGCGSGLS 65

  Fly    66 GSVLEDSEHMWIGIDISKSMLDIAVEREVAGDVILGDMGEGMPFKPGTFDGAISISALQWLCNAD 130
            |..|.:..|.|||:|||.|||.:||||||.||::|||||:|:..:.|..||||||||:|||||||
plant    66 GETLSEDGHHWIGLDISASMLHVAVEREVEGDLLLGDMGQGLGLRSGVIDGAISISAVQWLCNAD 130

  Fly   131 KSYHNPHKRLLKFFTTLFSCLTRTARAVFQFYPENSDQIEMVTSQAMKAGFYGGLVVDYPNSAKA 195
            ||.|.|..||..||.:|:.||:|.||||||.||||..|.|::..||::|||.||||||||:|.|.
plant   131 KSSHEPRLRLKAFFGSLYRCLSRGARAVFQVYPENIAQRELILRQALQAGFGGGLVVDYPHSTKK 195

  Fly   196 KKYYLVLMTG--------GSAELPQAL-----GSPEEERRVNYIKKRDACREARGKAPKKSRDWI 247
            :|.:|||..|        ...|..::.     ...||...|....:....:..|.....|.|:|:
plant   196 RKEFLVLTCGTVQTSIQTSKNEYDESCSEDDNSDDEESEEVGVSDRNRPRKRQRTNTKVKGREWV 260

  Fly   248 LAKKERRRRQGLETRPDTKYTARKRSGKF 276
            |.|||:.||:|.....|:|:|:|||..:|
plant   261 LRKKEQSRRKGKNVPADSKFTSRKRRTRF 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10903NP_001262365.1 Methyltransf_11 56..142 CDD:285453 58/85 (68%)
WBS_methylT 202..272 CDD:289366 21/82 (26%)
RID2NP_200538.1 UbiG 17..>92 CDD:332925 46/74 (62%)
Methyltransf_25 56..154 CDD:316196 63/97 (65%)
WBS_methylT 202..287 CDD:315297 23/84 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 114 1.000 Domainoid score I2016
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5486
Inparanoid 1 1.050 294 1.000 Inparanoid score I812
OMA 1 1.010 - - QHG53740
OrthoDB 1 1.010 - - D1138059at2759
OrthoFinder 1 1.000 - - FOG0004742
OrthoInspector 1 1.000 - - oto3870
orthoMCL 1 0.900 - - OOG6_102190
Panther 1 1.100 - - LDO PTHR12734
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3338
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.