DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10903 and Mettl27

DIOPT Version :9

Sequence 1:NP_001262365.1 Gene:CG10903 / 40952 FlyBaseID:FBgn0037543 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001102969.1 Gene:Mettl27 / 688407 RGDID:1588881 Length:253 Species:Rattus norvegicus


Alignment Length:219 Identity:58/219 - (26%)
Similarity:87/219 - (39%) Gaps:46/219 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FYNDDEAKKYSTNT-----RIIEIQVEMAERALELLALPDDDESRLILDIGCGSGLSGSVLEDSE 73
            || ||.|.:|..:.     |...:.|:...:||:  ..|.|   .||||:.||:||....|:...
  Rat    31 FY-DDWAPEYDQDVAALKYRAPRLAVDCLSQALQ--GPPHD---ALILDVACGTGLVAVELQARG 89

  Fly    74 HMWI-GIDISKSMLDIAVEREVAGDVILGDMG-EGMPFKPGTFDGAISISAL---QWLCNA---- 129
            .:.: |:|.|..||..|..|.:...:.|..:| |.:|:..||||..|.:.||   |..|:|    
  Rat    90 FLQVQGVDGSPEMLKQARARGLYHHLSLCTLGQEPLPYPKGTFDAVIIVGALSEGQVPCSAIPEL 154

  Fly   130 ---------------DKSYHNPHKRLLKFFTTLFSCLTRTARAVFQFYPENSDQIEMVTSQ---- 175
                           ....:.|:|..|:  ..|.|  ...|.|..:...:..|..|:.||:    
  Rat   155 LRVTKPGGLVCLTTRTNPSNLPYKEALE--AALDS--LEQAGAWERLVTQPVDHWELATSEQESG 215

  Fly   176 ---AMKAGFYGGLVVDYPNSAKAK 196
               ....||..|::..|.....|:
  Rat   216 LATCANDGFISGVIYLYRKQETAQ 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10903NP_001262365.1 Methyltransf_11 56..142 CDD:285453 30/109 (28%)
WBS_methylT 202..272 CDD:289366
Mettl27NP_001102969.1 Methyltransf_25 71..162 CDD:404528 29/90 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.